GenomeNet

>pbi:103067978 K19603 mitogen-activated protein kinase 15 [EC:2.7.11.24] | (RefSeq) mitogen-activated protein kinase 15-like isoform X2 (A)
MAMGPSASRLLQHRRAAGTFGLCDVPKGPGGASQAASPFKPLSLISQAQEAALNQHLMRK
GTIPSKAAGGLNPRNPESHGREAHFCLKPCKKMFQATANVGVAGDPKAHLGSYSQSYGTI
CKSALQSLPVSSTSHPALAPGPQQP

BLAST