GenomeNet

>pbn:PADG_00697 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) hypothetical protein (A)
MPLTIHHLHSSQSERIPWLCEELNIPYELKTYKRDPIFAPPEYKALHPSGAAPVIQDTLP
TNDGGSDAEPQTLILAESCACVEYISHKYGNGRLFLPSTHKDYATFLYWFHWANGTFQPL
LGRLLTVETIMSSIGGGGGGNSNSRSETQNQTLGSNPLIALWSGRRQRALRMLDNRFKKR
DEGGEEATWLAGEEFTAADIIVVFSLTTFRNWYRYSLQEYKGILGYLQRIGGREGYRRAM
AQVDPEMTLALDAEPPVKM

BLAST