GenomeNet

>pco:PHACADRAFT_180034 K03936 NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3] | (RefSeq) hypothetical protein (A)
MSLRLALRTGRLVRQLPVRQAAIGTACVARRFHASPSTQAPSESPFTEPTSPNPTIVRHA
ETTKALHEFGAYLLQCLPKFIQQFSVLKDELTLYTPPSGIVPVLTFLRDHSQGQFKSVMD
ITAVDFPERDKRFEVVYNLLSVRHGGRIRVKTYASEVDAVPTAASLYRGADWYEREVWDL
FGVYFEGHPDLRRILTDYGFEGHPLRKDFPLTGYTEVRYDEERKRVVYEPLQLTQAFRNF
DALSPWEQVGDGTTPKRPDEFKHVPLPPPPPAEKK

BLAST