GenomeNet

>pcw:110212707 K00622 arylamine N-acetyltransferase [EC:2.3.1.5] | (RefSeq) LOW QUALITY PROTEIN: arylamine N-acetyltransferase 1-like (A)
MDIREYFARIGYNHSGEKSDLETLIEVMLHHVQAVPFENLDIHCGIPISLSLEAVYDKIV
RRKRGGWCLEVNHLLFWVLTTMGYDTTILGGYVYNTIKRQYSTMIHLLLKVTIGEKAYIV
DGAFGRSHQIWQPMELVSGKDQPQTPCIFRLKEDNGIWYXDQLRRKQFIPNPEFQNSDLL
EKNEFRHIYSFTLQPRTIEEFESANIYLQTSPKSVFTSKSFCSLQTVDGIYCLVGWTLSH
RRFNYKENMDLVEFKILEYEDIEKILKDIFNICLEKKLVPKHGDRFFTI

BLAST