GenomeNet

>pfa:PF3D7_1246900 K08286 protein-serine/threonine kinase [EC:2.7.11.-] | (RefSeq) RAC-beta serine/threonine protein kinase (A)
MNHINFFKCFSERNREKNNIPSYTSDSTQQQKKKKDYKKYFNFLITKKNKRETHKSTNGE
EDYEHILYKNKTNVNIKEDNLKKDFDEYKEKKVNINGNVNNKKYSDKTTHINSVMTLEKN
MILNNDNNTLNNNKKKKKKKKKKKKKSYSVEGTKLLKIKEYKKRKFFKIHFFLNRKNKNN
DKREDPSKNIHDKRDISLEKNIINYNKYDMQFSFESVASNNINNNTHFKKDKKIINLKKY
NNAHRDLYKNNYTNVFLCKKSFSDDEYKNKNIINNDSPCKFQKQNYDSKSKQGIYKANYR
RFRDSCRQKLDLYKIHNRRNDVLFYGKGALKEIKKSMFDENKENAFYKDNMANCALNNMD
NKNRMENECLYKYDEKEEIGKKRLRNSMSLSYERKKRIRPESFNYLKVIGEGSYGKVMLV
KHVQNKKLYAMKILRKENILSRNQLEHTKVERNILKCVSHPFIVKMYYAFQTKQKLYFIL
EYCPGGELFFHLSKLREFSEETAKFYSSEIILALEYLHDLNIIYRDLKPENVLLDELGHI
RLTDFGLSKEGITETNLTKSLCGTPEYLAPEIIEQKGHGKAVDWWSLGIMLYEMLTGELP
FNNTNRNVLFESIKYQKLNYPKNLSPKAVDLLTKLFEKNPKKRLGSGGTDAQEIKKHPFF
KNINWNDVLYKKVKPPFKPKLFNQLDLQNFDKQFLNMPLKYSDQHENTNITFADPKNFVV
QDFNYNYYEFSGQQK

BLAST