GenomeNet

>pfw:PF1751_v1c14760 K13874 L-arabinonolactonase [EC:3.1.1.15] | (GenBank) hypothetical protein (A)
MRIEVLVDVKTTLGEGPVWDVEQQRLYWIDSADGRILRCTDDGRELRAWEVGQKIGSMAL
RQDGESAIVALQNGVHTLDLKSGELNLIADPEPHLPDNRLNDGKVDRQGRFIFGSMDTQE
DNASAKLYRLDADLSLHTLDEGIIVSNGPCWSPSGDTFYFCDTWSGEIWAYDYDLATGNV
SNRRTFAKVDTRGGGAADGCTVDAEGCLWQALVYAGKLVRYTPEGFVDRIIQMPVKKVTS
LTFGGPNLDTLFVTSMAKPPLPRFPADGQQRGALFAITGLGVQGIAERRFAS

BLAST