GenomeNet

>phau:PH4a_03920 K06195 ApaG protein | (GenBank) Co2+/Mg2+ efflux protein ApaG (A)
MFTSSKVAVQVQSVYIESQSSPDDQRYVFAYTVSIHNLNKCTIRLLRRYWLITNAQGHTT
EVQGEGVVGEQPLIEPGTQYRYTSGAVLETPMGTMEGHYEMIDADGRLFQIEIPVFRLAL
PTLIN

BLAST