GenomeNet

>pjd:Pjdr2_1089 K02435 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7] | (GenBank) glutamyl-tRNA(Gln) amidotransferase, C subunit (A)
MSITIKDVEHVANLARLELSNEEKEQFTGQLNAILKYAEKLDSLDTDNVEPTSHVLPITN
VMREDITRESLPIEKVLLNAPDEEDGQIKVPAVLE

BLAST