GenomeNet

>pmb:A9601_17601 K02890 large subunit ribosomal protein L22 | (GenBank) rplV; 50S ribosomal protein L22 (A)
MTKTPETTKKAIAHGNYVRGSASKVRRVLDQIRGRSYRDALIMLEFMPYRSTDPITKVLR
SAVANAEHNLGMDPSTLVISSAWANSGPVMKRYRPRAQGRAFSIKKQTCHISISVESAPT
ETNAEVQN

BLAST