GenomeNet

>pme:NATL1_21601 no KO assigned | (GenBank) Conserved hypothetical protein (A)
MTTKRCCRSCNQCVSSHFDSFSWCKLRKIKIHSEISSFVSCGHWIKKEPNFPKISEKFVH
QQLDFGKVLVE

BLAST