GenomeNet

>pmib:BB2000_0807 K11911 type VI secretion system protein VasL | (GenBank) tssO; TssO (A)
MLSAMKSESLVIKIGGSPLDTPEFIALKTEFNKLSHPARPEISWTLIESLCLSLFKNHGI
DLQSGAYYTIARLQQHGLSGFTEGCELLANVIVTYWDSLWPEKPNQRTEVLNWFNTKASA
LLRQQSYQAKDLRLIYRSERALQLIIDKLAKTTWEKLPKIENLLWFFQNLAKQIEKQEKQ
TQQDSAEPVSVPPLVCIQQPSKTTDKAAPTFVIETPQPASSFTVVAKKMSATRGFIWGCV
LSCILFLAVGFGVHLYLKQEMNAITSIPEGAAAKWLFKPQLNSYEYHLALLEKRSPLSNL
RLIDTMQEKAKNAWPTDAEQIYFTRNWQNLYQTRLENMPINDSWSETATLLQQLSNKIVQ
QERNRGSFTLSYLKTAIYDIQKQHNKVEPIEEKLRQLAVQIETGQPISPATFNNIDNKIN
GLLARYYDLQKQAEQQGLKPGSYSSFGLDHE

BLAST