GenomeNet

>pmib:BB2000_0809 K11910 type VI secretion system protein VasJ | (GenBank) tssM; TssM (A)
MMNNTSYAWKQQLLTALDEQQVSSAVNDNDADWEYIDSEMIKFGSLSHGQLDIKEIQRRC
LHLFETQTKDFRILVHLLRTLQHAGEPKELVLAAQILTDFNRQYWQSCYPTNMKLKSRLA
NQVLKRFETASESFCHAANSAMRDDILGSFAFLAQFWHEQSPALAEQIDDLSRDYNRIEN
NDAPIIVASPAEKEEKVQTPPVSESIETPTKNSLTPTINVNHQDERQWKQTLLQVADVIC
QQAPESSVGYRIRRYAIWHAITVLPQANAQGKTPLAPVSIDRVMDYKAQLTQASITLLNN
IEQSLSLSPYWLEGHMLAAQVAAKLGYGEVESGIIEELRIFLARLPELVNLHFSDMTPFF
PESVQQWLEQYNQTENGQLPPSNTNTAILEQEVLQCYEQQGLEAALKLIELNLASRSEPR
DRFYGQLLSAQLFELSGMDYMATQLYQQLNTSASHYSLADWEPNLIRQLMQKIDKKTEIT
MTMDRDQ

BLAST