GenomeNet

>pmib:BB2000_1878 K00925 acetate kinase [EC:2.7.2.1] | (GenBank) ackA; acetate kinase (A)
MSSKLVLVLNCGSSSLKFAIINPENGEEFLSGLAECFNLPEARLKWKMDGQKHEAALGAG
AAHSEALNFIVNTILAEKPELSQQIAAIGHRIVHGGEKFTKSVVITDEVIKGIEAAIPFA
PLHNPAHLIGIEEARKAFPHLINKMVAVFDTAFHQTMPEEAYLYALPYSLYKDHSIRRYG
AHGTSHFFVSREAAKMLNKPVDELNVITCHLGNGGSVSAIVNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIVFHLHDTLGMSVEDINKLLTKESGLLGLTEVTSDCRYVEDNYETKADAK
RAMDVYCHRLAKYIGSYCALMEGRLDAIIFTGGIGENAAMVRELSLKKLALLGFEVDHQR
NLDARFGKSGTITTDNSRLAVVIPTNEELVIAQDASRLTA

BLAST