GenomeNet

>pmn:PMN2A_0235 K01992 ABC-2 type transport system permease protein | (GenBank) putative multidrug efflux ABC transporter (A)
MRIFGLSFKVIKTLLTTQYAYMLEYRIEIALWALSGVLPFIMFSLWSQNDVGNSFGLNDI
GLARYFLSAFLVRQFSVVWVVFSFEEDSLSGRLSPYLLQPLHPLFRYVASHLAEQATRLP
FAIAIAITFFILNPSSFWLPSLPQLFLAYLSTHFAFTIAFLLQSLVAALCFWTEKSSALE
RLIFVPYLFLSGLLVPLSAFPSNVLKVAMLTPFPYLINFPAKILSGMPVDIFNGFLAQIL
WISILVPSVNILWKLGVKRYTAMGA

BLAST