GenomeNet

>pmn:PMN2A_0264 K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7] | (GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A (A)
MTFEDLRQKLKSGEVSSKELVQEKINRINELDPTLNSFLIVNTELALSKAEHIDKQIASG
DHLPPLSGIPIAIKDNLCTKGIKTTCASKILDNFVPPYESTVTKKLLNAGAIMIGKTNMD
EFAMGSSTETSAFGPTLNPWNITKVPGGSSGGSAASVAAGLCYGSLGSDTGGSIRQPASF
CGVVGMKPTYGRVSRWGLIAFASSLDQVGPFANNVSDAAEILQVISGKDELDSTTVDIPV
PNYLETLSKSIKGMKIGLIDNCFDHEGLATDVKESVLSSASLLENLGAEIVNISCPRFND
GIATYYVIAPSEASANLARYDGVKYGFRAEDEQSLIEMTSKSRALGFGSEVKRRILIGTY
ALSAGYVDAYYKKAQQVRTLIRRDFDDAFKKVDVLLAPTAPTTAFGSGDNIDNPMAMYLS
DLLTIPANLAGLPAISLPCGFDKYGLPIGLQLIGNVFEEGKLFQVANQFEKAAEVYKNRP
KTDFTL

BLAST