GenomeNet

>pmn:PMN2A_0328 K03703 excinuclease ABC subunit C | (GenBank) Excinuclease ABC subunit C (A)
MELTPLIRDKSRLSDFLKDIPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELS
PRISLMVRQVADIELIVTDNESEALTLESNLIKSHQPYFNVLLKDDKKYPYVCITWGDKY
PRIFLTRKRRQRQLKDKYYGPYVDVYLLRQTLFSIKKLFPLRQRRIPLYKDRTCLNYSIG
RCPGVCQEEISSEDYKNTLKRVEMIFQGRTDELRILLEKQMISFSESLKFEEAGSVRDQL
KGIDRLYESQKMIIPDSSVCRDIIAMASEENISSVQIFQMRSGKLIGRLGYFSDNSNFNS
SQILQQVIENHYSNVDPVEIPSEILVQHQLVNNILISDWLSEIKKQKVNINVPKRSRKAE
IIKLVEKNANLELQRIKQSQDKNLVELDDLTNILDLENIPKRIECYDISHIQGSDAVASQ
VVFIDGIAARQHYRRYKIKSPNIKIGHSDDFESMAEVITRRFRRWARFKEEGGDIDALLS
NESSVLDNLNLNDWPDLVVIDGGKGQLSSVVAALEGLKLDQNLNVISLAKKKEEVFIPKV
KQSLVTESNQPGMLLLRRLRDEAHRFAITFHRQKRSQRMKRSQLNEIPGLGPQRIKLLLE
HFRSIEAIQMATFSELSSTPGLGRSTAVVIRNYFHPDKNI

BLAST