GenomeNet

>pmn:PMN2A_0408 no KO assigned | (GenBank) hypothetical protein (A)
MSGWLYLIRNKDLYKIGITKNFENRMRQLKPDNVVAKLYTADFVKLERELHNRYKKFRIP
QTEYFRLENTHIKEIKKRISILNYPFILTFGICLKSILLLLLFFFLTLVVISLYINDLNI
AISKSLVWIERISFGLAFISLFVYSGKYLSFWNELKYRSTRLIIFLFFSFLFRLVAIFLS

BLAST