GenomeNet

>pmn:PMN2A_1983 no KO assigned | (GenBank) Hypothetical protein (A)
MQPSNKTILERSIGRPAMMAFVLLTGIYLTTGQLIPGVV

BLAST