GenomeNet

>pmn:PMN2A_1984 no KO assigned | (GenBank) Conserved hypothetical protein (A)
MGIRHKLMIIATTQKASEVIGGVEIFSPMGLTILTIGILFTVGVPLTMILKGKKD

BLAST