GenomeNet

>pmur:107291671 K01900 succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5] | (RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial (A)
AADQIKKLYNLFLQIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKTIFAMDDKS
ENEAMENEAAHYDLKYIGLDGNIACFVNGAGLAMATCDIISLNGGKPANFLDLGGGVKEA
QVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHE
AQRILNESGLPITSASDLEDAAKKAVACVTKK

BLAST