GenomeNet

>pon:100443647 K01312 trypsin [EC:3.4.21.4] | (RefSeq) trypsin-2 isoform X1 (A)
MNPLLILTFVAAAAAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSPINPKFSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSWTLDN
DILLIKLSTPAVINARVSTISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVL
TQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGQLQGIVSWGYGCAQKNRP
GVYTKVYNYVDWIKDTIAANS

BLAST