GenomeNet

>pon:100447656 K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] | (RefSeq) histone-lysine N-methyltransferase SETMAR isoform X1 (A)
MFAEAAKTTRPCGMAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVG
PGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNV
LCQCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFISKGRFVCEYAGEVLGFSEVQR
RIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSM
VPKLALFAAKDIVPEEELSYDYSGRYLNLTGSEDKERLDNGKLRKPCYCGAKSCTAFLPF
DSSLYCPLEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFK
MGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAI
IEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLI
LRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAA
GLIHYSFLNPGETITSEKYAQEIDEMHQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQ
KLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVKSRSTDF
YATGINQLISRWQKCVDCNGSYFD

BLAST