GenomeNet

>pon:100460447 K05623 transglutaminase 7 [EC:2.3.2.13] | (RefSeq) TGM7; protein-glutamine gamma-glutamyltransferase Z (A)
MDQVATLQLESVDLQSSRNNKEHHTQEMGVKRLTVRRGQPFYLQLSFSRPFQSQSDHITF
VAETGPKPSELLGTRATFFLTRVQPGNVWSTSDFTIDSNSLQVSLFTPANAVIGHYTLKI
EVPQGQGHSVTYPLGTFILLFNPWSPEDDVYLPSEILLQEYIMRDYGFVYKGHEKFITSW
PWNYGQFEEDIIDICFEILNKSLYYLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWGEDYSKGVSPLEWNGSVAILRQWSARGGQPVKYGQCWVFASVMCTVMRCLGIPTRVV
SNFRSAHNVDRNLTIDTYYDRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYDGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAH
NTSSIGKEISTKMVGSDQRHSITSSYKYPEGSPEERAVFMKASRKMLGPQRASLPFLDLL
ESGGLRDQPAQLQLHLAGIPEWGQDLQLLLRIQRVPDSTHPRGPIGLVVRFCAQALLHGG
GTQKPLWRHTVRLNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVEETGRSMLVL
KDISLEPPHLSIEVSERAEVGKALRVHVTLTNTLMLALSSCTMVLEGSGLVNGQVAKDLG
TLVAGHTLQIRLDLYPTKAGPRQLQVLISSNEVKEIKGYKDIFVTVAGAP

BLAST