GenomeNet

>ppb:PPUBIRD1_0438 K06195 ApaG protein | (GenBank) apaG; ApaG (A)
MSDPRYQIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLSAKLLSRHWLITNGDGEV
EEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQMFAEDGKRFDAEIAPFRLA
VPGALH

BLAST