GenomeNet

>ppl:POSPLDRAFT_57386 K01210 glucan 1,3-beta-glucosidase [EC:3.2.1.58] | (GenBank) hypothetical protein (A)
MSGLEHEHGSLTPPQPIQDVEGRPASVGRADSQYTADALGVPQAGLNPDPSLPSTPHESY
ATPGLGTSDNTPPFGTSSDAINANTSDAAAAAGVPATKETASTGSAEALAGTGTKGAGKA
PWYKRPIVWLAAFIALAIVVLVVVLPVWFVAVKPHRDHNTTSGTGKSGGPNPESPSGATS
GGNGSTITAADGTSFTYINNFGGSWVYDAENPFNNSARPNSWTPPLSEPWNWSTDRIWGV
NLGGLFELEPFISPELFQAHPNSVDEWTLDTDLRAGSNGSQNILAQMENYYNTFITEQDI
AEIAGAGLNWIRLPIPFWAIDVWDNVGVDSNGTVVSEPFLARVSWSYILRVLGWARKYGL
RINLDLHTIPGSQNGYNHSGKLGIVNFLNGVMGVANAERALEYIRVIAEFISQAEYQPVV
PLFSIVNEPLLATIGKDTLTTFYLRAHDMIRNITGIGEGHGPFIAIHDGFMGTAYWAGFL
QGSDRIALDTHPYFAFDNQPNNQPVNVTVANGSSLYGGQWPLLACNSWGAEMNNSREQFG
VTIAGEFSNAINDCGLWVRGVNTSADYVGNCDYWENWESWSDETKAGLKQFALASMDALG
DWFFWTWKIGNSSTSNSPQAPLWSYKLGLDNGWMPLDPREASGACESLGYIPVAWNDSFA
SWATGGAGAGTIAPTSVSQYGVWPPATINNVPTESISYLPQYTSTATVVSLPPASTYTAA
TVSTGNGWYDAQDRASAPTPIAGCTYPDAWSAVGSPIATAGCGAVAYAKREVPEPVVTAP
PARRGL

BLAST