GenomeNet

>ppr:PBPRA0667 K11900 type VI secretion system protein ImpC | (GenBank) RSP0744; conserved hypothetical protein (A)
MNAQTEALLDPATAETSRSFLEEAIVATKQTDSSRAEELLRTLTEEALKGTVTWNKNLTV
TFNDAIKGIDDAISSQLAEIMHQPEFQKLEGSWRGLHYLAMNSDTGQTLKIRMLSLSKKE
LHKDLSKAVEFDQSQIFKKVYEAEFGTPGGEPYGALIGDYEFTNHPEDIEMLGLMSNVAA
AGFSPFLSAASPELFGFDEWEELSKPRDLDKVFESLEYTQWRSFRESPDSRFVTLTMPRV
LSRLPYGQTTLPIEEFRYEELTIDDESGLAINAKHDDYCWMNASYVMGAKMTAAFSKYGF
CTAIRGAEGGGKVDNLPAHVFMSDDGDPDLKCPTEVGITDRRESELGRLGFLPLCHYKNT
NYAVFFGGQTCQKPTKFDTLEASANAEISARLPYMMATSRFAHYLKVMARDKIGSFMEAD
DVERWLNRWILSYVNATEDAGQEIRAKYPLADAKVKVQEIPGQPGAYHAVAWLRPWLQME
ELTTSLRLVAKIPEIS

BLAST