GenomeNet

>pps:100967581 K21852 dedicator of cytokinesis protein 6/7/8 | (RefSeq) DOCK8; dedicator of cytokinesis 8 (A)
MTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRE
WLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPRHLNVLCDV
SGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFALYPSVDEE
DAVEIRPVPECPKEHLGNRILVKLLTLKFEIDIEPLFASIALYDVKERKKISENFHCDLN
SDQFKGFLRAHTPSVAASSQARSAVFSVTFPSSDIYLVVKIEKVLQQGEIGDCAEPYTVI
KESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLEREVTDVDSVV
GRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLSDEDLFKFL
ADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRPHKEILEFP
TREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGP
EFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGY
SWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQA
VSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMGLEHELKLSIICLNSSRLEPL
VLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKDQHGRNCLL
ASYVHYVFRLPEVQRDVPKSGAPTALPDPRSYHTYGRTSAAAVSSKLLQARVISSSNPDL
AGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGNNDAPSSTAAPRPASKKHFHEELALQM
VVSTGMVRETVFKYAWFFFELLVKSMAQHVHNMDKRDSFRRTRFSDRFMDDITTIVNVVT
SEIAALLVKPQKENEQAEKMNISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSAKLSNLPT
LVSMRLEFLRILCSHEHYLNLNLFFMNADAAPTSPCPSISSQNSSSCSSFQDQKIASMFD
LTSEYRQQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAVHSLLSSHDLDPRCVKPEVK
VKIAALYLPLVGIILDALPQLCDFTVADTRRYRTSGSDEEQEGAGAINQNVALAIAGNNF
NLKTSGIVLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQSLIRKWIADLPSTQLNRIL
DLLFICVLCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRRRAPGNDR
FPGLNENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEAHLIILDMQENIIQAS
SALDCKDSLLGGVLRVLVNSLNCDQSTTYLTHCFATLRALIAKFGDLLFEEEVEQCFDLC
HQVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVGRAPDFNEE
HLRRSLRTILAYSEEDTAMQMTPFPTQVEELLCNLNSILYDTVKMREFQEDPEMLMDLMY
RIAKSYQASPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLEDHSYLPVG
SVSFQNISSNVLEESVVSDDTLSPDEDGVCAGQYFTESGLVGLLEQAAELFSTGGLYETV
NEVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFFGSKFGDLD
EQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFV
EPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYI
KTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDPKMLQMVLQGSVGATVNQG
PLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKK
NYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS

BLAST