GenomeNet

>pri:PRIO_4086 K01902 succinyl-CoA synthetase alpha subunit [EC:6.2.1.5] | (GenBank) sucD; Succinyl-CoA ligase [ADP-forming] subunit alpha (A)
MSILVDKNTKVITQGITGSTGLFHTKGALDYGTQMVGGVTPGKGGTTVNITLENGSEVSL
PVFDTVVAAKAATGATASVIYVPPAFAADSIMEAVDAGLELVICITEGIPVLDMVKVSRF
MEGRSTVLIGPNCPGVITPGECKIGIMPGYIHMPGYVGVVSRSGTLTYEAVHQLTERGIG
QSSAVGIGGDPVKGSEFIDILKLFNEDPGTKAVIMIGEIGGTAEEEAAEWIKENMTKPVV
GFIGGVTAPPGKRMGHAGAIISGGKGTASEKIAVLESCGIKVAPTPAEMGTTLVKVLEER
GILNAFTTH

BLAST