GenomeNet

>psoj:PHYSODRAFT_483447 K01874 methionyl-tRNA synthetase [EC:6.1.1.10] | (RefSeq) hypothetical protein (A)
MLRLRRSIARPRSSLCARLQSSASSASSSPARPSQTFITTPIFYVNAAPHIGHVHSAVLA
DALSRWFKVKRHDVLFTTGTDEHGLKVQEAAEKSGTTDYKAFCDEVSSRFNAIFDEANVD
CSRFIRTSDEDHHEAVAAFWRTIRDNEHIYLGNHESWYCKSDESFLTEMQVEDREEADGT
VIKVSKESGHPVEMLREENYKFRLSAFQGRLLQWLDENPDVIVPKSRYNEVRAAVTSGLR
DLSVSRLSEKIQWAIKVPDDDKHCVYVWLDALTNYLTSAGYPGDVDRAWPADYHIVGKDI
LKFHAIYWPAFLMAAGLPLPKKVVAHAHWTVGNVKMSKSLGNVVDPHEMLSKYGSDFVRF
FLLREGVLTNDGDFNADTLEDRVNSELADTLGNLVSRSTGKSVLVKGIVPKRPQLDRLTP
EDKELVAKGQALAAKVEQLFDTPDFARGLEEIVFFLHDVNRYAMPFLGGTPLQF

BLAST