GenomeNet

>psom:113299233 K04733 interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1] | (RefSeq) probable serine/threonine-protein kinase At1g01540 isoform X1 (A)
MASLIDTVYIELSKPTIIFGIKLWILITICIGLFIFLILCCIITCCCRKSSKKHKVGSYS
KNPNLEKIVTVPSNQSLVPPNQSLVPDQVQIDVNKTEHRLSVTSNRHASNRHSSARSYRI
NRSTSDIELDSIAPLEISPMAWVRWFTLRELNDATDIFSNDNVIGEGQYGIVYRGVLPDG
TWLAVKWLFNSRGQAENEFKAEVEALGHIRHKNLVTLLGYCLEGSSRMLVYEYVDNGNLN
QWLHKDVMQVSPLTWDMRLDILIGIAKGLSYLHEGLEHKIVHRDVKSCNILLDQYWNPKV
ADFGLSRVLDTDMTHVTTRVIGTYGYVAPEYACAGILNDRSDVYSFGVLVMEMVSGRSPS
SFSESPEEMSLVDWLKKLIETQRYNDIVDPKLPDIPSSKSLKSVLLLALRCVDPDAQQRP
KMGQIVHMLESTDRLHNHEFLQKHKITREASHSRH

BLAST