GenomeNet

>psom:113347854 K03283 heat shock 70kDa protein 1/2/6/8 | (RefSeq) heat shock 70 kDa protein (A)
MATTSEGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPHNTVFDAKRLIGRKISDPSVQNDMKLWPFKVIAGPGEKPMIVVNYKGEEKKFSA
EEISSMVLVKMREIAEAYLGQSIKNAVITVPAYFNDSQRQATKDAGSIAGLNVLRMINEP
TAAAIAYGLDKKASRAGEQNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVAEFKRKNKKDISGNARALRRLRTACERAKRTLSSTTQTTLEIDSLFEGMDFY
TTITRARFEELNMDMFRKCMEPVEKCLRDAKIDKSQVHEVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLI
PRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
NVVFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEDIEKMVKDAERYKAEDEQVKK
KVEAKNSLENYAYNMRNTVKDEKFAGKLDPSDKQKIEEAVEDTIKWLDGNQLAEVEEFED
KLKDLESICNPIISKMYQAGGGADMPGGAGFGGQDMPGGGGSTGGSGTGPKIEEVD

BLAST