GenomeNet

>psz:PSTAB_1199 no KO assigned | (GenBank) hypothetical protein (A)
MNLRPLLAAVVLFATFGASAQPAPVTNSRMVPAQVQPGADAALDERQAREWGLRSEEWAR
YRQLMQGPLGVYSPQLDPLTALGIEARSDEERRRYAELQVQAEAQRVGKTLAYQRAYDAA
WQRLFPGQPRVSLPGAKAQGAGNTGSGRLAVFVKADCAPCAQRVQQLQAAGTAFDLYMVG
SRQDDARIRQWATQAGIDPARVRARTITLNHDAGRWLSLGLPGDLPAVVREVNGQWQRQ

BLAST