GenomeNet

>ptr:741145 K09417 heat shock transcription factor 4 | (RefSeq) HSF4; heat shock factor protein 4 isoform X3 (A)
MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLP
QYFKHSNMASFVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGREQLLERVRRK
VPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQ
QHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPTPAKFNTCPLPGALLQDPYF
IQSPSTYSLSQRQLWALALTGPGAPSSLTSQKTLHPLRGPGFLPPVMAGAPPPLPVAVVQ
AILEGKGSFSPEGPRNAQQPEPGDPREIPDRGPLSLESGDRSPESLLPPMLLQPPQESVE
PIGPLDVLGPSLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSPGKDPTLGAP
LLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASPSP

BLAST