GenomeNet

>pwa:Pecwa_1643 no KO assigned | (GenBank) putative secreted protein (A)
MSPTHSTQRLFVSHLLIIAALSSGCTTTTAPPHSPPIKAVASVPDATPDFIPVLRYGRYT
LIELAPDAAQRDLLLQVIDVSIPEHSRATVGDGLRHALKRSGYQLCETAQSVIELYSLPL
PAAHLHLGPMTLRETLLTLAGPYWALYVDNRTRQVCFKRPDIDAGAGTANGDTQVADAVK
PLPPAGGQP

BLAST