GenomeNet

>raa:Q7S_19185 K06195 ApaG protein | (GenBank) apaG; CO2+/MG2+ efflux protein ApaG (A)
MLNSPRVCVQVQSFYVESQSIPEEERFVFAYTITIRNLGRFNVQLLRRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFYYTSGAILETPLGTMEGHYEMVAQDGETFRVPVPVFRLAI
PTLIN

BLAST