GenomeNet

>raf:RAF_ORF1198 K06180 23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23] | (GenBank) Ribosomal large subunit pseudouridine synthases RluD subfamily protein (A)
MLKYSVPHELNGIRLDKALSSLLENVSRNQIQKAIKDSQVLVNDVIISDPDVLVKENDII
LFSFKEPEELKIATANVALDIIYEDDDLIVINKAAGMTVHPGAGHHDDTLVNALLHHTKN
LSDIGSSERPGIVHRLDKDTTGLMVVAKNNKAHMLLANQIEQRQVIRKYKVLVWGVINPL
EGVIKNNIGRSRSDRQKMTILKYGGKEAVTHYKTLELFYKGSISMVECKLSTGRTHQIRV
QLSHLKHSIVGDQTYGNNDRKIAHSPPELKAKLIDFKRQALHSWYLSFTHPTSNEIMEFS
CELPRDMEEIISL

BLAST