GenomeNet

>rbn:RBXJA2T_02140 K02890 large subunit ribosomal protein L22 | (GenBank) rplV; 50S ribosomal protein L22 (A)
METKAIVRGVRLSADKGRLVADMIRGKKVDQAINILTFTPKKAAVIIKKAVESAVANAEH
NDGADIDELKIKSIYVEQGATLKRFSARAKGRGNRISKPTCHIFVTVGN

BLAST