GenomeNet

>rcn:112167642 K18592 gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14] | (RefSeq) LOW QUALITY PROTEIN: glutathione hydrolase 3-like (A)
MEDLRNYKVNVTDAMTANVLGYTISGMPPPSAGTLGLSMILNIFNSYGNSDAANGDLGLH
RLIEALKHMFAIRMNLGDPAFVDTHEYASDMLSPSFAKEIQQKIFDNTTFPPEYYSYRWS
QLRDHGTSHFCIVDADRNAVSMTTTVNYPFGGGVLSPSTAIVLNNEMGDFSIPTDISPDH
LPPAPSNFIEPIKRPLSSMTPIIVTKDNQLVGVLGGSGGLNIXVTQVFINYFILGMEPLA
AVQSPRVYHRLIPNIVSYENWTVSDGNHIELSDERKLFLQEQGHELXAKAGGAITQLIVQ
RLGNPIQMGRKCGRSSNENVFHGILTAVSDPRKDGRPAAV

BLAST