GenomeNet

>red:roselon_03215 K00925 acetate kinase [EC:2.7.2.1] | (GenBank) Acetate kinase (A)
MNRAILTLNAGSSSIKFGLYHAADDPVEEARGQVDGIGPEAALVLSDDGGRTRTAVDAPD
HGAALAAIIAALRPRLAGDEIAGVGHRVVHGGPYLDGPRHIDDDLITYLDTLSPLAPLHQ
PHNLAGIAAARRAFPGAPQIACFDTAFHRGHPWVNDTFALPRRFHDDGVRRYGFHGLSYD
YITSLLRHDFNNISQGNVIIAHLGNGSSLCATRDGVSIDSTMGFSALDGMPMGTRSGQLD
PGVMLYLMQSGMAAEALTTLLYKESGLKGLSGISHDMRTLRPRRTRARHRPWPITPPACR
ARSARWRPRSADWTGWFLPAGSARTPRPCGPWRLKSSGFWV

BLAST