GenomeNet

>rel:REMIM1_PF00467 K11894 type VI secretion system protein ImpI | (GenBank) type VI protein secretion system FHA domain-containing protein (A)
MRLELREITSDVAMPAGRSKWFFERGRRTLGRAPDCDWRLPEDRRSISKLHCIIERDRDG
FLLRDQSANGSRVDGVTVHEGEIARLSDRSRLEMGGLAFSVHISGSSDQEIEDPDAGLML
SDEPLTISAILADIAPGGRTASGILGERIADDWTLPEQGGRKGAASSRNVEIGWSGPPET
RSVTQLLPEDWNSDETDYGSHLEHGSATHVSVPIAQRRPAAIEIVNDNDPRPEAEAFPTL
TIGRPEAFADRLEPLLARLEEAVEGAYAIFDMNAPRSGPELDFLAGREEALLGRIETLLA
QQLKLNVALEALVHAAGRLEPRIVEAQVETGAWGLPWRRDRNYWQAYRAEFEKDGKSRSI
QDVFRDAMSDAVNGRKAGPRPQDGQEGKDAHHEE

BLAST