GenomeNet

>rel:REMIM1_PF00474 K11901 type VI secretion system protein ImpB | (GenBank) type VI secretion system-associated protein (A)
MRRRRASMASVHEKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPTQPLKA
FGERKFVQIDRDNFDDVMRRMTPGLTLSVENTLEKDGTELPVSLKFESMADFEPGAVVDQ
VPALKALLNARNQLRDLMSKADRSEELERLLEEILQNKADLSQLVAQLGGGKAGEAKDVL
N

BLAST