GenomeNet

>rin:ACS15_3979 K07248 lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21] | (GenBank) aldehyde dehydrogenase family protein (A)
MRTERNYVNGRFADAQCDAVIVVHNPATEAPFARVSAATADEAVAAVEAAAAAQKAWRKL
PSTERAAYLHKLADALTARAPEISAALARESGKSLEDASNEAIYAGQITRYHAEWARRIE
GEVIPSDAPDESLFLQREPIGVVACLIPFNYPVYTLLRKIAPALITGNTVVVRPSNNTPV
SAFEIAKAVEDAGFPPGVVNILAMDHATAEVLCTHAAVGMITLTGSVNAGRKVLDYCKVN
IAKPSLELGGKTPAIVEPDTDLEAVAAALVAAKVAHCGQRCTAIERVYVHESVHDRFVAL
LKGQMAAVRIGDRAVDPSCMGPQVSALARAGIHAMVEGAIADGATLETGGKLPDGPGFFY
PATLLTNCRQDMEIVQEETFGPILAVLRYSTIDEAIALANDHQFGLASVLYTENYRTAMK
VANAIESGELYVNRTPADPYQGYHAGWKRSGLGGDDGKHGMLEFTQTRLVVMKY

BLAST