GenomeNet

>rme:Rmet_3175 K06195 ApaG protein | (GenBank) apaG; protein associated with Co2+ and Mg2+ efflux (A)
MSEYAFSVAVRTQYMPDQSDPDRGRYAFAYTITIHNTGEVAAQLISRHWIITDSDNSTQE
VSGLGVVGHQPLLKPGEHFEYSSWATISTPVGSMKGDYFCVAEDGHRFEVPIPEFALVLP
RMLH

BLAST