GenomeNet

>rno:116700 K08522 glycoprotein hormones alpha chain | (RefSeq) Cga, Gpa1; glycoprotein hormones, alpha polypeptide (A)
MDCYRRYAAVILVMLSMVLHILHPLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS

BLAST