GenomeNet

>rno:24899 no KO assigned | (RefSeq) Smcp, Mcs, Mcsp; sperm mitochondria-associated cysteine-rich protein (A)
MSDSSKTNQCCPTPCCPPKPCCPPKPCCLQKSPCCPKSPCCPPKSPCCTPKVCPCPTPCP
CPATCPAACACPCPMKPCCPTKCTCCPKKCTCCPQPTCCVQPTCCSSENKTESDSDGSGQ
TQDRGAQTQQSPQGGQGNWNQKKTK

BLAST