GenomeNet

>rno:25056 no KO assigned | (RefSeq) Rbp1; retinol binding protein 1 (A)
MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRN
YIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM
RAEGVTCKQVFKKVH

BLAST