GenomeNet

>rno:25337 K08066 nuclear transcription factor Y, gamma | (RefSeq) Nfyc, CBF-C; nuclear transcription factor Y subunit gamma (A)
MSTEGGFGSTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQ
IQQVTMPAGQDLAQPMFIQSANQPSDGQTPQVTGD

BLAST