GenomeNet

>rno:25653 K05251 thyrotropin subunit beta | (RefSeq) Tshb; thyroid stimulating hormone, beta (A)
MNAVVLFSVLFALACGQVSSFCIPTEYMMYVDRRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYRDFTYRTVEIPGCPHHVAPYFSYPVALSCKCGKCNTDYSDCTHEAV
KTNYCTKPQTFYLGGFSG

BLAST