GenomeNet

>rno:300732 K12804 proline-serine-threonine phosphatase interacting protein 1 | (RefSeq) Pstpip1; proline-serine-threonine phosphatase-interacting protein 1 (A)
MTAQLQFRDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEELLRQRAQAEERYGKELVQI
ARKAGGQTEMNSLRTSFDSLKQQTENVGSAHIQLALALREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKTMESKKSYDQKCRDADDAEQAFERVSASGHQKQIEKSQTKAKQC
KESATEADRVYRQNIEQLEKARTEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLSM
QCVKDDELYEEVRLTLEGCDVEGDINGFIQSKSTGREPPAPVPYQNYYDREVTPLTGSPI
VQTSCGVIKRFSGLLHGSPKTTPSQAPAASTETLAPTSEQKELVYASIEVQATQGNLNSA
AQDYRALYDYTAQNSDELDISAGDILAVILEGEDGWWTVERNGQRGFVPGSYLEKL

BLAST