GenomeNet

>rno:306764 K15588 [histone H3]-lysine36 N-dimethyltransferase NSD1 [EC:2.1.1.357] | (RefSeq) Nsd1; nuclear receptor binding SET domain protein 1 (A)
MCHPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVANRRPYREYYVEA
FGDPSEKAWVAGKAIVMFEGRHQFEELPVLRKRGKQKEKGYRHKVPQKILSKWEASVGLA
EQCDVPRGPKTQKCVPSSAKLDSEEDMPFEDCANDPDSEHDLLLNGCLKSLAFDSEHSAD
EKEKPCAKSRVRKSSDNIKRTSVKKGLMPFEAQKEERRGKSPENLGLDFLSGGVSDKQAS
NELSRIANSLTGSSAAPGQFLFSSCGQNTAKTDFETPNCDSLSGLSESALISKHSGEKKK
LQPGQVCSSKVQLCYVGAGDEEKRSDSVSVCTTSDDGSSDLDPTEHNSEFHKSVLEVTDA
LDKTENALSMHKNETKYSRYPATNRVKEKQKSLITNSHTDHLMDSTKTVEPGTAEISQVN
LSDLKISSPIPKPQPEFRNDGLTTKFNAPPGIRNENSLTKGGLANQTLLPLKCRQPKFRS
IKCKHKESPTAAETSATSEDLSLKCCSSDTNGSPMTSISKSGKGEGLKLLNNMHEKTRDS
SDIETAVVKHVLSELKELSYRSLSEDVSDSGTSKSSKPLLFSSASSQNHIPIEPDYKFST
LLMMLKDMHDSKTKEQRLMTAQNVASYRTPDRGDCSSGSPVGTSKVLVLGGSTHNSEKPG
DSTQDSVRLSPGGGDSALSGELSSSLSVLPSDKRDLPACGKIRSNCIPRRNCGRAKLSPK
LRVTISTQMAKPSVNPKALKTERKRKLSRLPAVTLAANGLGNKESGGSVNGPLKGGAQDP
AKEEPLQQMDLLRNEETHFDSKVKQSDPDKILEKEPSFENRKGPEVGSEINIENDEPHGV
DQVVPKKRWQRLNQRRPKPGKRASRFREKENSEGAFGVLLPGDPVQKGRDDYLEQRAPPT
SILEDSAADPNHVSHSESVGPRLNVCDKSSVSMGDLEKETGIPSLTPQTKIPEPAVRSEK
KRLRKPSKWLLEYTEEYDQIFAPKKKQKKVQEQVHKVSSRCEDESLLARCRSSAQNKQVD
ENSLISTKEEPPVLEREAPFLEGPLVQSDLGVAHAELPQLTLSVPVAPEVSPRPTLESEE
LLVKTPGNYEGKRQRKPTKKLLESNDLDPGFMPKKGDLGLSRKCCESGHLENGVGDSRAT
PHLKEFGGGTTRIFDKPRKRKRQRHGTARVHYKRVKKEDSARETPSSAEGELMIHRTAAS
PKEILEEGIEHDPGMSASKRLQGERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLEC
LGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEECVQKYPPTVVQN
KGFRCPLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICP
NHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPEGNWYCNDCKA
GKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQA
RVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPY
KHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGR
CQNQCFSKRQYPDVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQE
HDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKA
GTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIVTEEKSRKFKRKPHGKRRSQ
GEVTKEREDECFSCGDGGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKE
AASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYVPPTATLSP
SPGTQQTEQSSEMGTQGPKKSDQPPTDATQMLSLSKKAVTGTCQRPLLPERPPERTDSSS
HLLDRIRDLAGSGTKSQSLVSSQRPQDRPPAKEGPRPQPPDRASPVTRPSSSPSVSSLPL
ERPLRMTEPRLDKSIGAASPKSQAVEKPPAPTGLRLSSPDRLLNTNSPKPQISDRPPDKS
HASLTQRLPPPEKVLSAVVQSLVAKEKALRPVDQNTQAKHRAAVVMDLIDLTPRQKERAA
SPQEVTAQADEKTPVLESSSRPTSRGLGHVPRAVEKGGVSDPLQPPGKSAAPSEHPWQAV
KSLTHARFLSPPSAKAFLYESAIQASGRAPVGSEQTPGPPSPAPGLLKQVKQLSRGLTAK
SGQSFRSLGKISASLPNEEKKLTTTEQSPWGLGKASPGAGLWPIVAGQTLAQACWSSGGT
QTLAQNCWSLGRGQDPKPEQNAIQALNQAPSSRKCAESEQK

BLAST